A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10247
Swiss-prot Accession number	Q91971 (Sequence in FASTA format)
Description	Glucagon-1 precursor (Glucagon I) [Contains: Glicentin-relatedpolypeptide 1 (GRPP 1); Glucagon-1; Glucagon-like peptide 1-1 (GLP 1-1); Glucagon-like peptide 2 (GLP 2)].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	178 Amino acids
Molecular weight	20034
References	1  PubMed abstract 7776976
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG
Position of mature hormone in Pre-Hormone protein	33 Residues from position (137-169)
Receptor	N/A
Gene ID	100136745
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10252
Swiss-prot Accession number	Q91189 (Sequence in FASTA format)
Description	Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide 2 (GRPP 2); Glucagon-2; Glucagon-like peptide 1-2 (GLP 1-2); Glucagon-like peptide 2 (GLP 2)].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	178 Amino acids
Molecular weight	19998
References	1  PubMed abstract 7776976
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG
Position of mature hormone in Pre-Hormone protein	33 Residues from position (137-169)
Receptor	N/A
Gene ID	100136748
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	11074
Swiss-prot Accession number	P04092 (Sequence in FASTA format)
Description	Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide (GRPP); Glucagon-2 (Glucagon II); Glucagon-like peptide 2(Glucagon-like peptide II)].
Source organism	Lophius americanus (American goosefish) (Anglerfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	122 Amino acids
Molecular weight	14171
References	1  PubMed abstract 6338015 2  PubMed abstract 3526301
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGTYTSDVSSYLQDQAAKDFVSWLKAGRG
Position of mature hormone in Pre-Hormone protein	31 Residues from position (89-119)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	11083
Swiss-prot Accession number	P01272 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20944
References	1  PubMed abstract 6577439 2   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 5102927 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628 8  PubMed abstract 6631957
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTVLDSLATRDFINWLLQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	N/A
Gene ID	280802
PDB ID	1KX6
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	11088
Swiss-prot Accession number	P29794 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	21115
References	1  PubMed abstract 11916259 2  PubMed abstract 3238052 3  PubMed abstract 10499540 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTVLDTLATRDFINWLLQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	N/A
Gene ID	403571
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	11091
Swiss-prot Accession number	P05110 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20972
References	1  PubMed abstract 3755107 2  PubMed abstract 3956884 3  PubMed abstract 4048553 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	11094
Swiss-prot Accession number	P68259 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)].
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1 and GLP-2. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis
Protein Length	206 Amino acids
Molecular weight	23876
References	1  PubMed abstract 2338135 2  PubMed abstract 7776976 3  PubMed abstract 1194290 4  PubMed abstract 2828209
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGTFTSDINKILDDMAAKEFLKWLINTKVTQ
Position of mature hormone in Pre-Hormone protein	33 Residues from position (166-198)
Receptor	N/A
Gene ID	396196
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	11097
Swiss-prot Accession number	O12956 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)].
Source organism	Heloderma suspectum (Gila monster)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Lepidosauria; Squamata; Scleroglossa; Anguimorpha; Helodermatidae;Heloderma.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Isoform LPII is expressed in both pancreas and intestine. Expression of isoform LPI is restricted to the pancreas. Neither isoform is detected in salivary glands
Post translational modification	N/A
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis
Protein Length	204 Amino acids
Molecular weight	23553
References	1  PubMed abstract 9020121 2  PubMed abstract 12554744 3  PubMed abstract 12626323 4  PubMed abstract 10322410 5  PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGTFTSDYNQLLDDIATQEFLKWLINQKVTQ
Position of mature hormone in Pre-Hormone protein	33 Residues from position (164-196)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11106
Swiss-prot Accession number	P01273 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Mesocricetus auratus (Golden hamster)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20954
References	1  PubMed abstract 6835407 2   Bell G.I.; Submitted (JUN-1985) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 12554744 4  PubMed abstract 12626323 5  PubMed abstract 10322410 6  PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTILDSLATRDFINWLIQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	11111
Swiss-prot Accession number	P22890 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Octodon degus (Degu)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Octodontidae; Octodon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	21166
References	1  PubMed abstract 2293024 2  PubMed abstract 12554744 3  PubMed abstract 12626323 4  PubMed abstract 10322410 5  PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTVLDHLATKDFINWLIQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	11116
Swiss-prot Accession number	P01274 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	21029
References	1   Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6894800 3  PubMed abstract 7045833 4   Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5  PubMed abstract 2753890 6  PubMed abstract 3379036 7  PubMed abstract 3530719 8  PubMed abstract 12554744 9  PubMed abstract 12626323 10  PubMed abstract 10322410 11  PubMed abstract 10605628 12  PubMed abstract 171582
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL
Position of mature hormone in Pre-Hormone protein	35 Residues from position (146-180)
Receptor	N/A
Gene ID	397595
PDB ID	1GCN
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	11122
Swiss-prot Accession number	P15438 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	103 Amino acids
Molecular weight	11721
References	1  PubMed abstract 3260236
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFTSDFNKALDIKAAQEFLDWIINTPVKE
Position of mature hormone in Pre-Hormone protein	33 Residues from position (71-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	11232
Swiss-prot Accession number	O42143 (Sequence in FASTA format)
Description	Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	266 Amino acids
Molecular weight	30951
References	1  PubMed abstract 9223287
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFTNDINKVLDIIAAQEFLDWVINTQETE
Position of mature hormone in Pre-Hormone protein	33 Residues from position (227-259)
Receptor	Q8UVY5    Detail in HMRbase
Gene ID	373686
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 14

HMRbase accession number	11333
Swiss-prot Accession number	P01275 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20909
References	1  PubMed abstract 2901414 2  PubMed abstract 3725587 3  PubMed abstract 6877358 4   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 5  PubMed abstract 15815621 6  PubMed abstract 15489334 7  PubMed abstract 11946536 8  PubMed abstract 2753890 9  PubMed abstract 8482423 10  PubMed abstract 14557443 11  PubMed abstract 14632334 12  PubMed abstract 9287128 13  PubMed abstract 12651102 14  PubMed abstract 14719035 15  PubMed abstract 12554744 16  PubMed abstract 12626323 17  PubMed abstract 10322410 18  PubMed abstract 10605628 19  PubMed abstract 9667960 20  PubMed abstract 11943215 21  PubMed abstract 12627948
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	P47871    Detail in HMRbase
Gene ID	2641
PDB ID	1BH0   1D0R   1NAU
Drugpedia	wiki
Comments

Search Result - 15

HMRbase accession number	11384
Swiss-prot Accession number	P06883 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20846
References	1  PubMed abstract 6094539 2  PubMed abstract 6548696 3  PubMed abstract 3528148 4  PubMed abstract 7937770 5  PubMed abstract 11564680 6  PubMed abstract 8721980 7  PubMed abstract 1692320 8  PubMed abstract 14719035 9  PubMed abstract 12554744 10  PubMed abstract 12626323 11  PubMed abstract 10322410 12  PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	P30082    Detail in HMRbase
Gene ID	24952
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	11480
Swiss-prot Accession number	P55095 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20906
References	1  PubMed abstract 7730317 2   Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 16141072 4  PubMed abstract 15489334 5  PubMed abstract 1886889 6  PubMed abstract 9407057 7  PubMed abstract 11356850 8  PubMed abstract 12554744 9  PubMed abstract 12626323 10  PubMed abstract 10322410 11  PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMSTILDNLATRDFINWLIQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	Q61606   Detail in HMRbase    Q3UN81    Detail in HMRbase
Gene ID	14526
PDB ID	N/A
Drugpedia	wiki
Comments